PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.4388s0020.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 367aa    MW: 40525.7 Da    PI: 6.6451
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.4388s0020.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-092933282055
                             HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
                Homeobox  20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                             +k +yps++++  LA+++gL+++q+ +WF N+R ++
  SapurV1A.4388s0020.1.p 293 HKWPYPSESQKLALAESTGLDQKQINNWFINQRKRH 328
                             4569*****************************885 PP

2ELK41.13.7e-14248269122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELK qLlrKYsgyLgsLkqEF+
  SapurV1A.4388s0020.1.p 248 ELKGQLLRKYSGYLGSLKQEFM 269
                             9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.4E-18112156IPR005540KNOX1
PfamPF037903.1E-20114152IPR005540KNOX1
SMARTSM012562.3E-24161212IPR005541KNOX2
PfamPF037911.7E-21164211IPR005541KNOX2
PfamPF037896.1E-11248269IPR005539ELK domain
SMARTSM011882.8E-8248269IPR005539ELK domain
PROSITE profilePS5121311.174248268IPR005539ELK domain
PROSITE profilePS5007112.989268331IPR001356Homeobox domain
SMARTSM003897.6E-14270335IPR001356Homeobox domain
SuperFamilySSF466892.4E-19270345IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-28273333IPR009057Homeodomain-like
CDDcd000861.06E-12280332No hitNo description
PfamPF059202.4E-16288327IPR008422Homeobox KN domain
PROSITE patternPS000270306329IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MEGGGAGGSS TTSLMMAFGD SSNGLCPLMM MMPLMSSSSS AHHQQQHVNA GGSSISNTLF  60
LPLPATPNQS QSRINNNAGG SSSMILDYPN NSTVTATGCY FMENSDGGGG STSVKAKIMA  120
HPHYHRLLAA YASCQKVGAP PEVVARLEEA CASAASMGPS NTYSIGEDPA LDQFMEAYCE  180
MLTKYEQELS KPLKEAMLFL QRVECQLRAL TLSSTSYAWG EGNDRNASSE EELDVNNKII  240
DPQAEDQELK GQLLRKYSGY LGSLKQEFMK KRKKGKLPKE ARQQLLDWWS RHHKWPYPSE  300
SQKLALAEST GLDQKQINNW FINQRKRHWK PSEDMQFVVM DAGHPHYYMD NVMGNPFPMD  360
FSHTLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1263272LKQEFMKKRK
2269273KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6849370.0AY684937.1 Populus balsamifera subsp. trichocarpa x Populus deltoides homeobox transcription factor KN2 (Kn2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304900.20.0Knox protein 1
SwissprotP466081e-156HSBH1_SOYBN; Homeobox protein SBH1
TrEMBLB9N8F40.0B9N8F4_POPTR; Knox protein 1
STRINGVIT_10s0116g00190.t011e-167(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20393480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62360.11e-135KNOX/ELK homeobox transcription factor